PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA30G00239
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 338aa    MW: 36748.7 Da    PI: 5.728
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA30G00239genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.21.1e-191358147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd+ll ++v+++G+++W++I++ ++ gR++k+c++rw + 
       AA30G00239 13 KGPWSPEEDDLLQRLVQKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 58
                     79******************************.***********985 PP

2Myb_DNA-binding54.42.8e-1767109347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++eEde +++a++++G++ W+tI+r ++ gRt++ +k++w++ 
       AA30G00239  67 AFSPEEDETIIRAHARFGNK-WATISRLLN-GRTDNAIKNHWNST 109
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.985863IPR017930Myb domain
SuperFamilySSF466891.05E-3110106IPR009057Homeodomain-like
SMARTSM007179.4E-181261IPR001005SANT/Myb domain
PfamPF002499.9E-201358IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-261466IPR009057Homeodomain-like
CDDcd001677.86E-171557No hitNo description
SMARTSM007171.9E-1464112IPR001005SANT/Myb domain
PROSITE profilePS5129420.48965114IPR017930Myb domain
PfamPF002497.1E-1567109IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2267113IPR009057Homeodomain-like
CDDcd001671.17E-1167110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MSGQNRKNME RIKGPWSPEE DDLLQRLVQK HGPRNWSLIS KSIPGRSGKS CRLRWCNQLS  60
PEVEHRAFSP EEDETIIRAH ARFGNKWATI SRLLNGRTDN AIKNHWNSTL KRKCSSNGVV  120
VSGEGQSCDF GVNGGYDGNL TDEQPLKRTA SGGGVVVSTG LYMSPGSPSG SDVSEQSSGY  180
HGFQGRTVVT TAEVTASSSA VDPPTYLSLS LPSVDCSETL TVRVNESTQE RVDQKMEMES  240
DYTAELFPVI REEEEEEERS KGLSGFNGDF MTVVQEMIRS EVRSYMTDLQ QGNVGNGVSG  300
AGAGGGGGGS CMPQGVNSRR VGFREFIAMN HIGIGKIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-41101131104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013595822.11e-170PREDICTED: transcription factor MYB44
SwissprotQ9FDW13e-92MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0D3A1B41e-170A0A0D3A1B4_BRAOL; Uncharacterized protein
STRINGBra011749.1-P1e-164(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.11e-152myb domain protein 73